Description
Product Description
Protein Description: selenoprotein O
Gene Name: SELENOO
Alternative Gene Name: SELO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035757: 79%, ENSRNOG00000060120: 76%
Entrez Gene ID: 83642
Uniprot ID: Q9BVL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SELENOO
Alternative Gene Name: SELO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035757: 79%, ENSRNOG00000060120: 76%
Entrez Gene ID: 83642
Uniprot ID: Q9BVL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DFTNTFYLLSSFPVELESPGLAEFLARLMEQCASLEELRLAFRPQMDPRQLSMMLMLAQSNPQLFALMGTRAGIARELERVEQQSRLEQ |
Gene Sequence | DFTNTFYLLSSFPVELESPGLAEFLARLMEQCASLEELRLAFRPQMDPRQLSMMLMLAQSNPQLFALMGTRAGIARELERVEQQSRLEQ |
Gene ID - Mouse | ENSMUSG00000035757 |
Gene ID - Rat | ENSRNOG00000060120 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SELENOO pAb (ATL-HPA071795) | |
Datasheet | Anti SELENOO pAb (ATL-HPA071795) Datasheet (External Link) |
Vendor Page | Anti SELENOO pAb (ATL-HPA071795) at Atlas Antibodies |
Documents & Links for Anti SELENOO pAb (ATL-HPA071795) | |
Datasheet | Anti SELENOO pAb (ATL-HPA071795) Datasheet (External Link) |
Vendor Page | Anti SELENOO pAb (ATL-HPA071795) |