Description
Product Description
Protein Description: sel-1 suppressor of lin-12-like 3 (C. elegans)
Gene Name: SEL1L3
Alternative Gene Name: KIAA0746
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029189: 70%, ENSRNOG00000004932: 67%
Entrez Gene ID: 23231
Uniprot ID: Q68CR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SEL1L3
Alternative Gene Name: KIAA0746
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029189: 70%, ENSRNOG00000004932: 67%
Entrez Gene ID: 23231
Uniprot ID: Q68CR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ERCAEVQEIVSVYASAAKHGGERQEACHLHNSYLDLQRRYGRPSMCRAFPWEKELKDKHPSLFQALLEMDLLTVPRNQNESVSEIGGKIFEKAVKRLSSIDGL |
Gene Sequence | ERCAEVQEIVSVYASAAKHGGERQEACHLHNSYLDLQRRYGRPSMCRAFPWEKELKDKHPSLFQALLEMDLLTVPRNQNESVSEIGGKIFEKAVKRLSSIDGL |
Gene ID - Mouse | ENSMUSG00000029189 |
Gene ID - Rat | ENSRNOG00000004932 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SEL1L3 pAb (ATL-HPA058792) | |
Datasheet | Anti SEL1L3 pAb (ATL-HPA058792) Datasheet (External Link) |
Vendor Page | Anti SEL1L3 pAb (ATL-HPA058792) at Atlas Antibodies |
Documents & Links for Anti SEL1L3 pAb (ATL-HPA058792) | |
Datasheet | Anti SEL1L3 pAb (ATL-HPA058792) Datasheet (External Link) |
Vendor Page | Anti SEL1L3 pAb (ATL-HPA058792) |