Anti SEC23B pAb (ATL-HPA069974)

Atlas Antibodies

Catalog No: ATL-HPA069974-25

• 
• 

Product Description

Protein Description: Sec23 homolog B, COPII coat complex component
Gene Name: SEC23B
Alternative Gene Name: CDA-II, CDAII, CDAN2, HEMPAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020986: 96%, ENSRNOG00000004657: 96%
Entrez Gene ID: 10483
Uniprot ID: Q15437
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IDIYACALDQTGLLEMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKD
• Gene Sequence: IDIYACALDQTGLLEMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKD
• Gene ID - Mouse: ENSMUSG00000020986
• Gene ID - Rat: ENSRNOG00000004657
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.