Protein Description: Sec23 homolog B, COPII coat complex component
Gene Name: SEC23B
Alternative Gene Name: CDA-II, CDAII, CDAN2, HEMPAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020986: 96%, ENSRNOG00000004657: 96%
Entrez Gene ID: 10483
Uniprot ID: Q15437
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SEC23B
Alternative Gene Name: CDA-II, CDAII, CDAN2, HEMPAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020986: 96%, ENSRNOG00000004657: 96%
Entrez Gene ID: 10483
Uniprot ID: Q15437
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IDIYACALDQTGLLEMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKD |
| Documents & Links for Anti SEC23B pAb (ATL-HPA069974) | |
| Datasheet | Anti SEC23B pAb (ATL-HPA069974) Datasheet (External Link) |
| Vendor Page | Anti SEC23B pAb (ATL-HPA069974) at Atlas |
| Documents & Links for Anti SEC23B pAb (ATL-HPA069974) | |
| Datasheet | Anti SEC23B pAb (ATL-HPA069974) Datasheet (External Link) |
| Vendor Page | Anti SEC23B pAb (ATL-HPA069974) |