Anti SEC13 pAb (ATL-HPA057943)

Atlas Antibodies

Catalog No: ATL-HPA057943-25

• 

Product Description

Protein Description: SEC13 homolog, nuclear pore and COPII coat complex component
Gene Name: SEC13
Alternative Gene Name: D3S1231E, npp-20, SEC13L1, SEC13R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030298: 97%, ENSRNOG00000010628: 97%
Entrez Gene ID: 6396
Uniprot ID: P55735
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD
• Gene Sequence: IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD
• Gene ID - Mouse: ENSMUSG00000030298
• Gene ID - Rat: ENSRNOG00000010628
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.