Anti SDR42E2 pAb (ATL-HPA061278)

Atlas Antibodies

Catalog No: ATL-HPA061278-25

• 

Product Description

Protein Description: short chain dehydrogenase/reductase family 42E, member 2
Gene Name: SDR42E2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109392: 91%, ENSRNOG00000051819: 53%
Entrez Gene ID:
Uniprot ID: A6NKP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VASYGMSGAEKLQKEQIESINVGGTKLVIDVCVR
• Gene Sequence: VASYGMSGAEKLQKEQIESINVGGTKLVIDVCVR
• Gene ID - Mouse: ENSMUSG00000109392
• Gene ID - Rat: ENSRNOG00000051819
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.