Protein Description: short chain dehydrogenase/reductase family 39U member 1
Gene Name: SDR39U1
Alternative Gene Name: C14orf124, HCDI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022223: 86%, ENSRNOG00000020544: 90%
Entrez Gene ID: 56948
Uniprot ID: Q9NRG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SDR39U1
Alternative Gene Name: C14orf124, HCDI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022223: 86%, ENSRNOG00000020544: 90%
Entrez Gene ID: 56948
Uniprot ID: Q9NRG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VNLAGENILNPLRRWNETFQKEVLGSRLETTQLLAKAITKAPQPPKAWVLVTGVAYYQPSLTAEYDEDSPGGDFDFFSNLVTKWEAAA |
| Documents & Links for Anti SDR39U1 pAb (ATL-HPA075356) | |
| Datasheet | Anti SDR39U1 pAb (ATL-HPA075356) Datasheet (External Link) |
| Vendor Page | Anti SDR39U1 pAb (ATL-HPA075356) at Atlas |
| Documents & Links for Anti SDR39U1 pAb (ATL-HPA075356) | |
| Datasheet | Anti SDR39U1 pAb (ATL-HPA075356) Datasheet (External Link) |
| Vendor Page | Anti SDR39U1 pAb (ATL-HPA075356) |