Protein Description: succinate dehydrogenase complex assembly factor 3
Gene Name: SDHAF3
Alternative Gene Name: ACN9, DC11, Sdh7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042505: 84%, ENSRNOG00000011283: 83%
Entrez Gene ID: 57001
Uniprot ID: Q9NRP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SDHAF3
Alternative Gene Name: ACN9, DC11, Sdh7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042505: 84%, ENSRNOG00000011283: 83%
Entrez Gene ID: 57001
Uniprot ID: Q9NRP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | YATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKP |
Documents & Links for Anti SDHAF3 pAb (ATL-HPA020523) | |
Datasheet | Anti SDHAF3 pAb (ATL-HPA020523) Datasheet (External Link) |
Vendor Page | Anti SDHAF3 pAb (ATL-HPA020523) at Atlas |
Documents & Links for Anti SDHAF3 pAb (ATL-HPA020523) | |
Datasheet | Anti SDHAF3 pAb (ATL-HPA020523) Datasheet (External Link) |
Vendor Page | Anti SDHAF3 pAb (ATL-HPA020523) |