Description
Product Description
Protein Description: succinate dehydrogenase complex, subunit A, flavoprotein (Fp)
Gene Name: SDHA
Alternative Gene Name: FP, SDH2, SDHF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021577: 94%, ENSRNOG00000013331: 96%
Entrez Gene ID: 6389
Uniprot ID: P31040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SDHA
Alternative Gene Name: FP, SDH2, SDHF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021577: 94%, ENSRNOG00000013331: 96%
Entrez Gene ID: 6389
Uniprot ID: P31040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEES |
Gene Sequence | VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEES |
Gene ID - Mouse | ENSMUSG00000021577 |
Gene ID - Rat | ENSRNOG00000013331 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SDHA pAb (ATL-HPA064582 w/enhanced validation) | |
Datasheet | Anti SDHA pAb (ATL-HPA064582 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SDHA pAb (ATL-HPA064582 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SDHA pAb (ATL-HPA064582 w/enhanced validation) | |
Datasheet | Anti SDHA pAb (ATL-HPA064582 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SDHA pAb (ATL-HPA064582 w/enhanced validation) |