Protein Description: scratch family zinc finger 2
Gene Name: SCRT2
Alternative Gene Name: ZNF898B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060257: 97%, ENSRNOG00000005148: 97%
Entrez Gene ID: 85508
Uniprot ID: Q9NQ03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCRT2
Alternative Gene Name: ZNF898B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060257: 97%, ENSRNOG00000005148: 97%
Entrez Gene ID: 85508
Uniprot ID: Q9NQ03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | APEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAF |
| Documents & Links for Anti SCRT2 pAb (ATL-HPA067697) | |
| Datasheet | Anti SCRT2 pAb (ATL-HPA067697) Datasheet (External Link) |
| Vendor Page | Anti SCRT2 pAb (ATL-HPA067697) at Atlas |
| Documents & Links for Anti SCRT2 pAb (ATL-HPA067697) | |
| Datasheet | Anti SCRT2 pAb (ATL-HPA067697) Datasheet (External Link) |
| Vendor Page | Anti SCRT2 pAb (ATL-HPA067697) |