Protein Description: sodium channel, non voltage gated 1 gamma subunit
Gene Name: SCNN1G
Alternative Gene Name: ENaCgamma, SCNEG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000216: 90%, ENSRNOG00000017842: 90%
Entrez Gene ID: 6340
Uniprot ID: P51170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCNN1G
Alternative Gene Name: ENaCgamma, SCNEG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000216: 90%, ENSRNOG00000017842: 90%
Entrez Gene ID: 6340
Uniprot ID: P51170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQ |
Documents & Links for Anti SCNN1G pAb (ATL-HPA071194) | |
Datasheet | Anti SCNN1G pAb (ATL-HPA071194) Datasheet (External Link) |
Vendor Page | Anti SCNN1G pAb (ATL-HPA071194) at Atlas |
Documents & Links for Anti SCNN1G pAb (ATL-HPA071194) | |
Datasheet | Anti SCNN1G pAb (ATL-HPA071194) Datasheet (External Link) |
Vendor Page | Anti SCNN1G pAb (ATL-HPA071194) |