Anti SCNN1G pAb (ATL-HPA071194)

Atlas Antibodies

Catalog No: ATL-HPA071194-25

• 

Product Description

Protein Description: sodium channel, non voltage gated 1 gamma subunit
Gene Name: SCNN1G
Alternative Gene Name: ENaCgamma, SCNEG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000216: 90%, ENSRNOG00000017842: 90%
Entrez Gene ID: 6340
Uniprot ID: P51170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQ
• Gene Sequence: SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQ
• Gene ID - Mouse: ENSMUSG00000000216
• Gene ID - Rat: ENSRNOG00000017842
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.