Description
Product Description
Protein Description: sodium voltage-gated channel alpha subunit 8
Gene Name: SCN8A
Alternative Gene Name: CerIII, CIAT, MED, NaCh6, Nav1.6, PN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023033: 96%, ENSRNOG00000005309: 93%
Entrez Gene ID: 6334
Uniprot ID: Q9UQD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCN8A
Alternative Gene Name: CerIII, CIAT, MED, NaCh6, Nav1.6, PN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023033: 96%, ENSRNOG00000005309: 93%
Entrez Gene ID: 6334
Uniprot ID: Q9UQD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSV |
Gene Sequence | QEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSV |
Gene ID - Mouse | ENSMUSG00000023033 |
Gene ID - Rat | ENSRNOG00000005309 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SCN8A pAb (ATL-HPA073590) | |
Datasheet | Anti SCN8A pAb (ATL-HPA073590) Datasheet (External Link) |
Vendor Page | Anti SCN8A pAb (ATL-HPA073590) at Atlas Antibodies |
Documents & Links for Anti SCN8A pAb (ATL-HPA073590) | |
Datasheet | Anti SCN8A pAb (ATL-HPA073590) Datasheet (External Link) |
Vendor Page | Anti SCN8A pAb (ATL-HPA073590) |