Description
Product Description
Protein Description: sodium voltage-gated channel alpha subunit 7
Gene Name: SCN7A
Alternative Gene Name: NaG, Nav2.1, Nav2.2, SCN6A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034810: 58%, ENSRNOG00000029342: 46%
Entrez Gene ID: 6332
Uniprot ID: Q01118
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCN7A
Alternative Gene Name: NaG, Nav2.1, Nav2.2, SCN6A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034810: 58%, ENSRNOG00000029342: 46%
Entrez Gene ID: 6332
Uniprot ID: Q01118
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LAMAYEEEKQRVGEISKKIEPKFQQTGKELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWY |
Gene Sequence | LAMAYEEEKQRVGEISKKIEPKFQQTGKELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWY |
Gene ID - Mouse | ENSMUSG00000034810 |
Gene ID - Rat | ENSRNOG00000029342 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SCN7A pAb (ATL-HPA072715) | |
Datasheet | Anti SCN7A pAb (ATL-HPA072715) Datasheet (External Link) |
Vendor Page | Anti SCN7A pAb (ATL-HPA072715) at Atlas Antibodies |
Documents & Links for Anti SCN7A pAb (ATL-HPA072715) | |
Datasheet | Anti SCN7A pAb (ATL-HPA072715) Datasheet (External Link) |
Vendor Page | Anti SCN7A pAb (ATL-HPA072715) |