Anti SCN7A pAb (ATL-HPA072715)

Atlas Antibodies

Catalog No: ATL-HPA072715-25

• 

Product Description

Protein Description: sodium voltage-gated channel alpha subunit 7
Gene Name: SCN7A
Alternative Gene Name: NaG, Nav2.1, Nav2.2, SCN6A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034810: 58%, ENSRNOG00000029342: 46%
Entrez Gene ID: 6332
Uniprot ID: Q01118
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAMAYEEEKQRVGEISKKIEPKFQQTGKELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWY
• Gene Sequence: LAMAYEEEKQRVGEISKKIEPKFQQTGKELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWY
• Gene ID - Mouse: ENSMUSG00000034810
• Gene ID - Rat: ENSRNOG00000029342
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.