Description
Product Description
Protein Description: sodium voltage-gated channel alpha subunit 5
Gene Name: SCN5A
Alternative Gene Name: CDCD2, CMD1E, CMPD2, HB1, HB2, HBBD, HH1, ICCD, IVF, LQT3, Nav1.5, PFHB1, SSS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032511: 84%, ENSRNOG00000015049: 86%
Entrez Gene ID: 6331
Uniprot ID: Q14524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCN5A
Alternative Gene Name: CDCD2, CMD1E, CMPD2, HB1, HB2, HBBD, HH1, ICCD, IVF, LQT3, Nav1.5, PFHB1, SSS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032511: 84%, ENSRNOG00000015049: 86%
Entrez Gene ID: 6331
Uniprot ID: Q14524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS |
Gene Sequence | HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS |
Gene ID - Mouse | ENSMUSG00000032511 |
Gene ID - Rat | ENSRNOG00000015049 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SCN5A pAb (ATL-HPA063346) | |
Datasheet | Anti SCN5A pAb (ATL-HPA063346) Datasheet (External Link) |
Vendor Page | Anti SCN5A pAb (ATL-HPA063346) at Atlas Antibodies |
Documents & Links for Anti SCN5A pAb (ATL-HPA063346) | |
Datasheet | Anti SCN5A pAb (ATL-HPA063346) Datasheet (External Link) |
Vendor Page | Anti SCN5A pAb (ATL-HPA063346) |