Protein Description: sex comb on midleg-like 4 (Drosophila)
Gene Name: SCML4
Alternative Gene Name: dJ47M23.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044770: 87%, ENSRNOG00000026110: 90%
Entrez Gene ID: 256380
Uniprot ID: Q8N228
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCML4
Alternative Gene Name: dJ47M23.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044770: 87%, ENSRNOG00000026110: 90%
Entrez Gene ID: 256380
Uniprot ID: Q8N228
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KSRVLMTPLALSPPRSTPEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERK |
| Documents & Links for Anti SCML4 pAb (ATL-HPA063326) | |
| Datasheet | Anti SCML4 pAb (ATL-HPA063326) Datasheet (External Link) |
| Vendor Page | Anti SCML4 pAb (ATL-HPA063326) at Atlas |
| Documents & Links for Anti SCML4 pAb (ATL-HPA063326) | |
| Datasheet | Anti SCML4 pAb (ATL-HPA063326) Datasheet (External Link) |
| Vendor Page | Anti SCML4 pAb (ATL-HPA063326) |