Description
Product Description
Protein Description: sex comb on midleg-like 2 (Drosophila)
Gene Name: SCML2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000037: 57%, ENSRNOG00000003726: 58%
Entrez Gene ID: 10389
Uniprot ID: Q9UQR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCML2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000037: 57%, ENSRNOG00000003726: 58%
Entrez Gene ID: 10389
Uniprot ID: Q9UQR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SRSVPGTTSSPLVGDISPKSSPHEVKFQMQRKSEAPSYIAVPDPSVLKQGFSKDPSTWSVDEVIQFMKHTDPQISGPLADLFR |
Gene Sequence | SRSVPGTTSSPLVGDISPKSSPHEVKFQMQRKSEAPSYIAVPDPSVLKQGFSKDPSTWSVDEVIQFMKHTDPQISGPLADLFR |
Gene ID - Mouse | ENSMUSG00000000037 |
Gene ID - Rat | ENSRNOG00000003726 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SCML2 pAb (ATL-HPA064713 w/enhanced validation) | |
Datasheet | Anti SCML2 pAb (ATL-HPA064713 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SCML2 pAb (ATL-HPA064713 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SCML2 pAb (ATL-HPA064713 w/enhanced validation) | |
Datasheet | Anti SCML2 pAb (ATL-HPA064713 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SCML2 pAb (ATL-HPA064713 w/enhanced validation) |