Anti SCLY pAb (ATL-HPA055760)

Catalog No:
ATL-HPA055760-100
$554.00

Description

Product Description

Protein Description: selenocysteine lyase
Gene Name: SCLY
Alternative Gene Name: SCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026307: 90%, ENSRNOG00000020083: 91%
Entrez Gene ID: 51540
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNS
Gene Sequence LYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNS
Gene ID - Mouse ENSMUSG00000026307
Gene ID - Rat ENSRNOG00000020083
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SCLY pAb (ATL-HPA055760)
Datasheet Anti SCLY pAb (ATL-HPA055760) Datasheet (External Link)
Vendor Page Anti SCLY pAb (ATL-HPA055760) at Atlas Antibodies

Documents & Links for Anti SCLY pAb (ATL-HPA055760)
Datasheet Anti SCLY pAb (ATL-HPA055760) Datasheet (External Link)
Vendor Page Anti SCLY pAb (ATL-HPA055760)

Product Description

Protein Description: selenocysteine lyase
Gene Name: SCLY
Alternative Gene Name: SCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026307: 90%, ENSRNOG00000020083: 91%
Entrez Gene ID: 51540
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNS
Gene Sequence LYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNS
Gene ID - Mouse ENSMUSG00000026307
Gene ID - Rat ENSRNOG00000020083
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SCLY pAb (ATL-HPA055760)
Datasheet Anti SCLY pAb (ATL-HPA055760) Datasheet (External Link)
Vendor Page Anti SCLY pAb (ATL-HPA055760) at Atlas Antibodies

Documents & Links for Anti SCLY pAb (ATL-HPA055760)
Datasheet Anti SCLY pAb (ATL-HPA055760) Datasheet (External Link)
Vendor Page Anti SCLY pAb (ATL-HPA055760)