Description
Product Description
Protein Description: selenocysteine lyase
Gene Name: SCLY
Alternative Gene Name: SCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026307: 90%, ENSRNOG00000020083: 91%
Entrez Gene ID: 51540
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCLY
Alternative Gene Name: SCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026307: 90%, ENSRNOG00000020083: 91%
Entrez Gene ID: 51540
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNS |
Gene Sequence | LYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNS |
Gene ID - Mouse | ENSMUSG00000026307 |
Gene ID - Rat | ENSRNOG00000020083 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SCLY pAb (ATL-HPA055760) | |
Datasheet | Anti SCLY pAb (ATL-HPA055760) Datasheet (External Link) |
Vendor Page | Anti SCLY pAb (ATL-HPA055760) at Atlas Antibodies |
Documents & Links for Anti SCLY pAb (ATL-HPA055760) | |
Datasheet | Anti SCLY pAb (ATL-HPA055760) Datasheet (External Link) |
Vendor Page | Anti SCLY pAb (ATL-HPA055760) |