Anti SCIN pAb (ATL-HPA020518 w/enhanced validation)

Atlas

Catalog No: ATL-HPA020518-25

• 
• 

Protein Description: scinderin
Gene Name: SCIN
Alternative Gene Name: adseverin, KIAA1905
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002565: 87%, ENSRNOG00000004498: 87%
Entrez Gene ID: 85477
Uniprot ID: Q9Y6U3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: LKANQVATGIRYNERKGRSELIVVEEGSEPSELIKVLGEKPELPDGGDDDDIIADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHG

Citations for Anti SCIN pAb (ATL-HPA020518 w/enhanced validation) – 2 Found

Jian, Wenjing; Zhang, Xiaoli; Wang, Jiguo; Liu, Yunlong; Hu, Chuting; Wang, Xianming; Liu, Renbin. Scinderin-knockdown inhibits proliferation and promotes apoptosis in human breast carcinoma cells. Oncology Letters. 2018;16(3):3207-3214. 

Lin, Qi; Li, Jun; Zhu, Dexiang; Niu, Zhengchuan; Pan, Xiangou; Xu, Pingping; Ji, Meiling; Wei, Ye; Xu, Jianmin. Aberrant Scinderin Expression Correlates With Liver Metastasis and Poor Prognosis in Colorectal Cancer. Frontiers In Pharmacology. 10( 31736743):1183.