Protein Description: secretogranin V
Gene Name: SCG5
Alternative Gene Name: 7B2, SGNE1, SgV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023236: 98%, ENSRNOG00000007542: 98%
Entrez Gene ID: 6447
Uniprot ID: P05408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCG5
Alternative Gene Name: 7B2, SGNE1, SgV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023236: 98%, ENSRNOG00000007542: 98%
Entrez Gene ID: 6447
Uniprot ID: P05408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHE |
Documents & Links for Anti SCG5 pAb (ATL-HPA074618 w/enhanced validation) | |
Datasheet | Anti SCG5 pAb (ATL-HPA074618 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SCG5 pAb (ATL-HPA074618 w/enhanced validation) at Atlas |
Documents & Links for Anti SCG5 pAb (ATL-HPA074618 w/enhanced validation) | |
Datasheet | Anti SCG5 pAb (ATL-HPA074618 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SCG5 pAb (ATL-HPA074618 w/enhanced validation) |