Protein Description: secretogranin II
Gene Name: SCG2
Alternative Gene Name: CHGC, SgII, SN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050711: 76%, ENSRNOG00000015055: 62%
Entrez Gene ID: 7857
Uniprot ID: P13521
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCG2
Alternative Gene Name: CHGC, SgII, SN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050711: 76%, ENSRNOG00000015055: 62%
Entrez Gene ID: 7857
Uniprot ID: P13521
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NPVEEKIESQTQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERA |
| Gene ID - Mouse | ENSMUSG00000050711 |
| Gene ID - Rat | ENSMUSG00000050711 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SCG2 pAb (ATL-HPA075062 w/enhanced validation) | |
| Datasheet | Anti SCG2 pAb (ATL-HPA075062 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SCG2 pAb (ATL-HPA075062 w/enhanced validation) at Atlas |
| Documents & Links for Anti SCG2 pAb (ATL-HPA075062 w/enhanced validation) | |
| Datasheet | Anti SCG2 pAb (ATL-HPA075062 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SCG2 pAb (ATL-HPA075062 w/enhanced validation) |