Anti SCARF1 pAb (ATL-HPA072936)

Catalog No:
ATL-HPA072936-25
$447.00

Description

Product Description

Protein Description: scavenger receptor class F, member 1
Gene Name: SCARF1
Alternative Gene Name: KIAA0149, SREC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038188: 62%, ENSRNOG00000031163: 31%
Entrez Gene ID: 8578
Uniprot ID: Q14162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPI
Gene Sequence PNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPI
Gene ID - Mouse ENSMUSG00000038188
Gene ID - Rat ENSRNOG00000031163
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SCARF1 pAb (ATL-HPA072936)
Datasheet Anti SCARF1 pAb (ATL-HPA072936) Datasheet (External Link)
Vendor Page Anti SCARF1 pAb (ATL-HPA072936) at Atlas Antibodies

Documents & Links for Anti SCARF1 pAb (ATL-HPA072936)
Datasheet Anti SCARF1 pAb (ATL-HPA072936) Datasheet (External Link)
Vendor Page Anti SCARF1 pAb (ATL-HPA072936)

Product Description

Protein Description: scavenger receptor class F, member 1
Gene Name: SCARF1
Alternative Gene Name: KIAA0149, SREC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038188: 62%, ENSRNOG00000031163: 31%
Entrez Gene ID: 8578
Uniprot ID: Q14162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPI
Gene Sequence PNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPI
Gene ID - Mouse ENSMUSG00000038188
Gene ID - Rat ENSRNOG00000031163
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SCARF1 pAb (ATL-HPA072936)
Datasheet Anti SCARF1 pAb (ATL-HPA072936) Datasheet (External Link)
Vendor Page Anti SCARF1 pAb (ATL-HPA072936) at Atlas Antibodies

Documents & Links for Anti SCARF1 pAb (ATL-HPA072936)
Datasheet Anti SCARF1 pAb (ATL-HPA072936) Datasheet (External Link)
Vendor Page Anti SCARF1 pAb (ATL-HPA072936)