Anti SCARF1 pAb (ATL-HPA072936)

Atlas Antibodies

Catalog No: ATL-HPA072936-25

• 

Product Description

Protein Description: scavenger receptor class F, member 1
Gene Name: SCARF1
Alternative Gene Name: KIAA0149, SREC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038188: 62%, ENSRNOG00000031163: 31%
Entrez Gene ID: 8578
Uniprot ID: Q14162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPI
• Gene Sequence: PNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPI
• Gene ID - Mouse: ENSMUSG00000038188
• Gene ID - Rat: ENSRNOG00000031163
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.