Protein Description: scavenger receptor class F, member 1
Gene Name: SCARF1
Alternative Gene Name: KIAA0149, SREC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038188: 62%, ENSRNOG00000031163: 31%
Entrez Gene ID: 8578
Uniprot ID: Q14162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCARF1
Alternative Gene Name: KIAA0149, SREC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038188: 62%, ENSRNOG00000031163: 31%
Entrez Gene ID: 8578
Uniprot ID: Q14162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PNSAPKAGLPGATGPMAVRPEEAVRGLGAGTESSRRAQEPVSGCGSPEQDPQKQAEEERQEEPEYENVVPI |
| Documents & Links for Anti SCARF1 pAb (ATL-HPA072936) | |
| Datasheet | Anti SCARF1 pAb (ATL-HPA072936) Datasheet (External Link) |
| Vendor Page | Anti SCARF1 pAb (ATL-HPA072936) at Atlas |
| Documents & Links for Anti SCARF1 pAb (ATL-HPA072936) | |
| Datasheet | Anti SCARF1 pAb (ATL-HPA072936) Datasheet (External Link) |
| Vendor Page | Anti SCARF1 pAb (ATL-HPA072936) |