Protein Description: scavenger receptor class B member 1
Gene Name: SCARB1
Alternative Gene Name: CD36L1, CLA-1, CLA1, SR-BI, SRB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037936: 83%, ENSRNOG00000000981: 80%
Entrez Gene ID: 949
Uniprot ID: Q8WTV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCARB1
Alternative Gene Name: CD36L1, CLA-1, CLA1, SR-BI, SRB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037936: 83%, ENSRNOG00000000981: 80%
Entrez Gene ID: 949
Uniprot ID: Q8WTV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL |
Documents & Links for Anti SCARB1 pAb (ATL-HPA072449 w/enhanced validation) | |
Datasheet | Anti SCARB1 pAb (ATL-HPA072449 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SCARB1 pAb (ATL-HPA072449 w/enhanced validation) at Atlas |
Documents & Links for Anti SCARB1 pAb (ATL-HPA072449 w/enhanced validation) | |
Datasheet | Anti SCARB1 pAb (ATL-HPA072449 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SCARB1 pAb (ATL-HPA072449 w/enhanced validation) |