Anti SCAPER pAb (ATL-HPA061180)

Atlas Antibodies

Catalog No: ATL-HPA061180-25

• 

Product Description

Protein Description: S-phase cyclin A-associated protein in the ER
Gene Name: SCAPER
Alternative Gene Name: Zfp291, ZNF291
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034007: 76%, ENSRNOG00000006864: 75%
Entrez Gene ID: 49855
Uniprot ID: Q9BY12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVKAHHTGSTASSEITPAQSCPPMTVQKASRKNERKDAEGWETVQRGRPIRSRSTAVMPKVSLATEATRSKDDSDKENVCLLPDESIQKGQFVGDGTSNTIESHPKDSLHSCDHPLA
• Gene Sequence: KVKAHHTGSTASSEITPAQSCPPMTVQKASRKNERKDAEGWETVQRGRPIRSRSTAVMPKVSLATEATRSKDDSDKENVCLLPDESIQKGQFVGDGTSNTIESHPKDSLHSCDHPLA
• Gene ID - Mouse: ENSMUSG00000034007
• Gene ID - Rat: ENSRNOG00000006864
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.