Protein Description: suppressor of cancer cell invasion
Gene Name: SCAI
Alternative Gene Name: C9orf126, FLJ36664, NET40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035236: 98%, ENSRNOG00000025278: 99%
Entrez Gene ID: 286205
Uniprot ID: Q8N9R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SCAI
Alternative Gene Name: C9orf126, FLJ36664, NET40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035236: 98%, ENSRNOG00000025278: 99%
Entrez Gene ID: 286205
Uniprot ID: Q8N9R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFT |
Documents & Links for Anti SCAI pAb (ATL-HPA020632) | |
Datasheet | Anti SCAI pAb (ATL-HPA020632) Datasheet (External Link) |
Vendor Page | Anti SCAI pAb (ATL-HPA020632) at Atlas |
Documents & Links for Anti SCAI pAb (ATL-HPA020632) | |
Datasheet | Anti SCAI pAb (ATL-HPA020632) Datasheet (External Link) |
Vendor Page | Anti SCAI pAb (ATL-HPA020632) |