Protein Description: sterol-C5-desaturase
Gene Name: SC5D
Alternative Gene Name: SC5DL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032018: 84%, ENSRNOG00000008305: 81%
Entrez Gene ID: 6309
Uniprot ID: O75845
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SC5D
Alternative Gene Name: SC5DL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032018: 84%, ENSRNOG00000008305: 81%
Entrez Gene ID: 6309
Uniprot ID: O75845
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DLVLRVADYYFFTPYVYPATWPEDDIFRQAI |
| Documents & Links for Anti SC5D pAb (ATL-HPA066283) | |
| Datasheet | Anti SC5D pAb (ATL-HPA066283) Datasheet (External Link) |
| Vendor Page | Anti SC5D pAb (ATL-HPA066283) at Atlas |
| Documents & Links for Anti SC5D pAb (ATL-HPA066283) | |
| Datasheet | Anti SC5D pAb (ATL-HPA066283) Datasheet (External Link) |
| Vendor Page | Anti SC5D pAb (ATL-HPA066283) |