Anti SBSN pAb (ATL-HPA062568 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062568-25

• 

Product Description

Protein Description: suprabasin
Gene Name: SBSN
Alternative Gene Name: HLAR698, UNQ698
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046056: 55%, ENSRNOG00000021015: 50%
Entrez Gene ID: 374897
Uniprot ID: Q6UWP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVNNAAGQAGKEADKAVQGFHTGVH
• Gene Sequence: KELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVNNAAGQAGKEADKAVQGFHTGVH
• Gene ID - Mouse: ENSMUSG00000046056
• Gene ID - Rat: ENSRNOG00000021015
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.