Description
Product Description
Protein Description: suprabasin
Gene Name: SBSN
Alternative Gene Name: HLAR698, UNQ698
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046056: 55%, ENSRNOG00000021015: 50%
Entrez Gene ID: 374897
Uniprot ID: Q6UWP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SBSN
Alternative Gene Name: HLAR698, UNQ698
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046056: 55%, ENSRNOG00000021015: 50%
Entrez Gene ID: 374897
Uniprot ID: Q6UWP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVNNAAGQAGKEADKAVQGFHTGVH |
Gene Sequence | KELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVNNAAGQAGKEADKAVQGFHTGVH |
Gene ID - Mouse | ENSMUSG00000046056 |
Gene ID - Rat | ENSRNOG00000021015 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SBSN pAb (ATL-HPA062568 w/enhanced validation) | |
Datasheet | Anti SBSN pAb (ATL-HPA062568 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SBSN pAb (ATL-HPA062568 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SBSN pAb (ATL-HPA062568 w/enhanced validation) | |
Datasheet | Anti SBSN pAb (ATL-HPA062568 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SBSN pAb (ATL-HPA062568 w/enhanced validation) |