Description
Product Description
Protein Description: SET binding factor 1
Gene Name: SBF1
Alternative Gene Name: DENND7A, MTMR5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036529: 89%, ENSRNOG00000008392: 89%
Entrez Gene ID: 6305
Uniprot ID: O95248
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SBF1
Alternative Gene Name: DENND7A, MTMR5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036529: 89%, ENSRNOG00000008392: 89%
Entrez Gene ID: 6305
Uniprot ID: O95248
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CYDSCPRAQPDAISRLLEELQRLETELGQPAERWKDTWDRVKAAQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYL |
Gene Sequence | CYDSCPRAQPDAISRLLEELQRLETELGQPAERWKDTWDRVKAAQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYL |
Gene ID - Mouse | ENSMUSG00000036529 |
Gene ID - Rat | ENSRNOG00000008392 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SBF1 pAb (ATL-HPA074004) | |
Datasheet | Anti SBF1 pAb (ATL-HPA074004) Datasheet (External Link) |
Vendor Page | Anti SBF1 pAb (ATL-HPA074004) at Atlas Antibodies |
Documents & Links for Anti SBF1 pAb (ATL-HPA074004) | |
Datasheet | Anti SBF1 pAb (ATL-HPA074004) Datasheet (External Link) |
Vendor Page | Anti SBF1 pAb (ATL-HPA074004) |