Anti SAPCD1 pAb (ATL-HPA071699)

Atlas Antibodies

Catalog No: ATL-HPA071699-25

• 

Product Description

Protein Description: suppressor APC domain containing 1
Gene Name: SAPCD1
Alternative Gene Name: C6orf26, NG23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036185: 71%, ENSRNOG00000000858: 67%
Entrez Gene ID: 401251
Uniprot ID: Q5SSQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REQDALWQGLELLQHGQAWFEDHLREAQRQQLHLGALGENFLTDLHSEPGRPPLAQIQKVNICLQNLIHEKE
• Gene Sequence: REQDALWQGLELLQHGQAWFEDHLREAQRQQLHLGALGENFLTDLHSEPGRPPLAQIQKVNICLQNLIHEKE
• Gene ID - Mouse: ENSMUSG00000036185
• Gene ID - Rat: ENSRNOG00000000858
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.