Protein Description: SAP30 like
Gene Name: SAP30L
Alternative Gene Name: FLJ11526, NS4ATP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020519: 94%, ENSRNOG00000002575: 94%
Entrez Gene ID: 79685
Uniprot ID: Q9HAJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SAP30L
Alternative Gene Name: FLJ11526, NS4ATP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020519: 94%, ENSRNOG00000002575: 94%
Entrez Gene ID: 79685
Uniprot ID: Q9HAJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIE |
| Documents & Links for Anti SAP30L pAb (ATL-HPA078308) | |
| Datasheet | Anti SAP30L pAb (ATL-HPA078308) Datasheet (External Link) |
| Vendor Page | Anti SAP30L pAb (ATL-HPA078308) at Atlas |
| Documents & Links for Anti SAP30L pAb (ATL-HPA078308) | |
| Datasheet | Anti SAP30L pAb (ATL-HPA078308) Datasheet (External Link) |
| Vendor Page | Anti SAP30L pAb (ATL-HPA078308) |