Anti SAMD5 pAb (ATL-HPA067811)

Atlas Antibodies

Catalog No: ATL-HPA067811-25

• 
• 

Product Description

Protein Description: sterile alpha motif domain containing 5
Gene Name: SAMD5
Alternative Gene Name: dJ875H10.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060487: 100%, ENSRNOG00000023549: 100%
Entrez Gene ID: 389432
Uniprot ID: Q5TGI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRIL
• Gene Sequence: MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRIL
• Gene ID - Mouse: ENSMUSG00000060487
• Gene ID - Rat: ENSRNOG00000023549
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.