Description
Product Description
Protein Description: sterile alpha motif domain containing 5
Gene Name: SAMD5
Alternative Gene Name: dJ875H10.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060487: 100%, ENSRNOG00000023549: 100%
Entrez Gene ID: 389432
Uniprot ID: Q5TGI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SAMD5
Alternative Gene Name: dJ875H10.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060487: 100%, ENSRNOG00000023549: 100%
Entrez Gene ID: 389432
Uniprot ID: Q5TGI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRIL |
Gene Sequence | MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRIL |
Gene ID - Mouse | ENSMUSG00000060487 |
Gene ID - Rat | ENSRNOG00000023549 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SAMD5 pAb (ATL-HPA067811) | |
Datasheet | Anti SAMD5 pAb (ATL-HPA067811) Datasheet (External Link) |
Vendor Page | Anti SAMD5 pAb (ATL-HPA067811) at Atlas Antibodies |
Documents & Links for Anti SAMD5 pAb (ATL-HPA067811) | |
Datasheet | Anti SAMD5 pAb (ATL-HPA067811) Datasheet (External Link) |
Vendor Page | Anti SAMD5 pAb (ATL-HPA067811) |