Anti SAMD4B pAb (ATL-HPA059385)

Atlas Antibodies

Catalog No: ATL-HPA059385-25

• 

Product Description

Protein Description: sterile alpha motif domain containing 4B
Gene Name: SAMD4B
Alternative Gene Name: FLJ10211, hSmaug2, MGC99832, SMGB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109336: 79%, ENSRNOG00000019831: 80%
Entrez Gene ID: 55095
Uniprot ID: Q5PRF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPLPGAEPPLAHPGTDKGTEAKDPPAVENYPPPP
• Gene Sequence: IIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPLPGAEPPLAHPGTDKGTEAKDPPAVENYPPPP
• Gene ID - Mouse: ENSMUSG00000109336
• Gene ID - Rat: ENSRNOG00000019831
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.