Protein Description: sterile alpha motif domain containing 4A
Gene Name: SAMD4A
Alternative Gene Name: DKFZP434H0350, hSmaug1, KIAA1053, SAMD4, Smaug, SMG, SMGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021838: 90%, ENSRNOG00000010489: 90%
Entrez Gene ID: 23034
Uniprot ID: Q9UPU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SAMD4A
Alternative Gene Name: DKFZP434H0350, hSmaug1, KIAA1053, SAMD4, Smaug, SMG, SMGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021838: 90%, ENSRNOG00000010489: 90%
Entrez Gene ID: 23034
Uniprot ID: Q9UPU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQN |
| Documents & Links for Anti SAMD4A pAb (ATL-HPA065309) | |
| Datasheet | Anti SAMD4A pAb (ATL-HPA065309) Datasheet (External Link) |
| Vendor Page | Anti SAMD4A pAb (ATL-HPA065309) at Atlas |
| Documents & Links for Anti SAMD4A pAb (ATL-HPA065309) | |
| Datasheet | Anti SAMD4A pAb (ATL-HPA065309) Datasheet (External Link) |
| Vendor Page | Anti SAMD4A pAb (ATL-HPA065309) |
| Citations for Anti SAMD4A pAb (ATL-HPA065309) – 1 Found |
| Ahn, Jinsoo; Kim, Dong-Hwan; Park, Mi-Ryung; Suh, Yeunsu; Lee, Haesun; Hwang, Seongsoo; Mamuad, Lovelia L; Lee, Sang Suk; Lee, Kichoon. A novel testis-enriched gene, Samd4a, regulates spermatogenesis as a spermatid-specific factor. Frontiers In Cell And Developmental Biology. 10( 36274854):978343. PubMed |