Protein Description: spalt like transcription factor 1
Gene Name: SALL1
Alternative Gene Name: Hsal1, TBS, ZNF794
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031665: 92%, ENSRNOG00000013907: 92%
Entrez Gene ID: 6299
Uniprot ID: Q9NSC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SALL1
Alternative Gene Name: Hsal1, TBS, ZNF794
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031665: 92%, ENSRNOG00000013907: 92%
Entrez Gene ID: 6299
Uniprot ID: Q9NSC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ISESTSSMQALSPSNSTQEFHKSPSIEEKPQRAVPSEFANGLSPTPVNGGALDLTSSHAEK |
Documents & Links for Anti SALL1 pAb (ATL-HPA074673) | |
Datasheet | Anti SALL1 pAb (ATL-HPA074673) Datasheet (External Link) |
Vendor Page | Anti SALL1 pAb (ATL-HPA074673) at Atlas |
Documents & Links for Anti SALL1 pAb (ATL-HPA074673) | |
Datasheet | Anti SALL1 pAb (ATL-HPA074673) Datasheet (External Link) |
Vendor Page | Anti SALL1 pAb (ATL-HPA074673) |