Protein Description: SAC1 suppressor of actin mutations 1-like (yeast)
Gene Name: SACM1L
Alternative Gene Name: KIAA0851, SAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025240: 98%, ENSRNOG00000005149: 100%
Entrez Gene ID: 22908
Uniprot ID: Q9NTJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SACM1L
Alternative Gene Name: KIAA0851, SAC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025240: 98%, ENSRNOG00000005149: 100%
Entrez Gene ID: 22908
Uniprot ID: Q9NTJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKT |
| Documents & Links for Anti SACM1L pAb (ATL-HPA069869) | |
| Datasheet | Anti SACM1L pAb (ATL-HPA069869) Datasheet (External Link) |
| Vendor Page | Anti SACM1L pAb (ATL-HPA069869) at Atlas |
| Documents & Links for Anti SACM1L pAb (ATL-HPA069869) | |
| Datasheet | Anti SACM1L pAb (ATL-HPA069869) Datasheet (External Link) |
| Vendor Page | Anti SACM1L pAb (ATL-HPA069869) |
| Citations for Anti SACM1L pAb (ATL-HPA069869) – 1 Found |
| Kutchukian, Candice; Vivas, Oscar; Casas, Maria; Jones, Julia G; Tiscione, Scott A; Simó, Sergi; Ory, Daniel S; Dixon, Rose E; Dickson, Eamonn J. NPC1 regulates the distribution of phosphatidylinositol 4-kinases at Golgi and lysosomal membranes. The Embo Journal. 2021;40(13):e105990. PubMed |