Anti S100B pAb (ATL-HPA015768 w/enhanced validation)

Catalog No:
ATL-HPA015768-25
$328.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: S100 calcium binding protein B
Gene Name: S100B
Alternative Gene Name: S100beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033208: 99%, ENSRNOG00000001295: 98%
Entrez Gene ID: 6285
Uniprot ID: P04271
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Gene Sequence LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Gene ID - Mouse ENSMUSG00000033208
Gene ID - Rat ENSRNOG00000001295
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti S100B pAb (ATL-HPA015768 w/enhanced validation)
Datasheet Anti S100B pAb (ATL-HPA015768 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti S100B pAb (ATL-HPA015768 w/enhanced validation) at Atlas

Documents & Links for Anti S100B pAb (ATL-HPA015768 w/enhanced validation)
Datasheet Anti S100B pAb (ATL-HPA015768 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti S100B pAb (ATL-HPA015768 w/enhanced validation)

Citations for Anti S100B pAb (ATL-HPA015768 w/enhanced validation) – 19 Found
Hanson, M Gartz; Fregoso, Veronica L; Vrana, Justin D; Tucker, Chandra L; Niswander, Lee A. Peripheral nervous system defects in a mouse model for peroxisomal biogenesis disorders. Developmental Biology. 2014;395(1):84-95.  PubMed
Zhou, Li-Na; Cui, Xiao-Jun; Su, Kai-Xin; Wang, Xiao-Hong; Guo, Jin-Hua. Beneficial reciprocal effects of bone marrow stromal cells and Schwann cells from adult rats in a dynamic co‑culture system in vitro without intercellular contact. Molecular Medicine Reports. 2015;12(4):4931-8.  PubMed
Pattwell, Siobhan S; Liston, Conor; Jing, Deqiang; Ninan, Ipe; Yang, Rui R; Witztum, Jonathan; Murdock, Mitchell H; Dincheva, Iva; Bath, Kevin G; Casey, B J; Deisseroth, Karl; Lee, Francis S. Dynamic changes in neural circuitry during adolescence are associated with persistent attenuation of fear memories. Nature Communications. 2016;7( 27215672):11475.  PubMed
Wright, Jordan L; Ermine, Charlotte M; Jørgensen, Jesper R; Parish, Clare L; Thompson, Lachlan H. Over-Expression of Meteorin Drives Gliogenesis Following Striatal Injury. Frontiers In Cellular Neuroscience. 10( 27458346):177.  PubMed
Wang, Ying; Wu, Wei; Wu, Xiangbing; Sun, Yan; Zhang, Yi P; Deng, Ling-Xiao; Walker, Melissa Jane; Qu, Wenrui; Chen, Chen; Liu, Nai-Kui; Han, Qi; Dai, Heqiao; Shields, Lisa Be; Shields, Christopher B; Sengelaub, Dale R; Jones, Kathryn J; Smith, George M; Xu, Xiao-Ming. Remodeling of lumbar motor circuitry remote to a thoracic spinal cord injury promotes locomotor recovery. Elife. 2018;7( 30207538)  PubMed
Yang, Fei; Yang, Lingli; Teng, Lanting; Zhang, Huimin; Katayama, Ichiro. Morphological Alterations and Increased S100B Expression in Epidermal Langerhans Cells Detected in Skin from Patients with Progressive Vitiligo. Life (Basel, Switzerland). 2021;11(6)  PubMed
Brault, Véronique; Nguyen, Thu Lan; Flores-Gutiérrez, Javier; Iacono, Giovanni; Birling, Marie-Christine; Lalanne, Valérie; Meziane, Hamid; Manousopoulou, Antigoni; Pavlovic, Guillaume; Lindner, Loïc; Selloum, Mohammed; Sorg, Tania; Yu, Eugene; Garbis, Spiros D; Hérault, Yann. Dyrk1a gene dosage in glutamatergic neurons has key effects in cognitive deficits observed in mouse models of MRD7 and Down syndrome. Plos Genetics. 2021;17(9):e1009777.  PubMed
Chang, Xiao-Yue; Chen, Kai; Cheng, Tong; Lai, Pui To; Zhang, Li; So, Kwok-Fai; Yang, Edward S. In vivo neuronal and astrocytic activation in somatosensory cortex by acupuncture stimuli. Neural Regeneration Research. 2022;17(11):2526-2529.  PubMed
Chaichana, Kaisorn L; Guerrero-Cazares, Hugo; Capilla-Gonzalez, Vivian; Zamora-Berridi, Grettel; Achanta, Pragathi; Gonzalez-Perez, Oscar; Jallo, George I; Garcia-Verdugo, Jose Manuel; Quiñones-Hinojosa, Alfredo. Intra-operatively obtained human tissue: protocols and techniques for the study of neural stem cells. Journal Of Neuroscience Methods. 2009;180(1):116-25.  PubMed
Uhlén, Mathias; Oksvold, Per; Älgenäs, Cajsa; Hamsten, Carl; Fagerberg, Linn; Klevebring, Daniel; Lundberg, Emma; Odeberg, Jacob; Pontén, Fredrik; Kondo, Tadashi; Sivertsson, Åsa. Antibody-based protein profiling of the human chromosome 21. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013458.  PubMed
Darcy, Michael J; Trouche, Stéphanie; Jin, Shan-Xue; Feig, Larry A. Age-dependent role for Ras-GRF1 in the late stages of adult neurogenesis in the dentate gyrus. Hippocampus. 2014;24(3):315-25.  PubMed
Kielar, Michel; Tuy, Françoise Phan Dinh; Bizzotto, Sara; Lebrand, Cécile; de Juan Romero, Camino; Poirier, Karine; Oegema, Renske; Mancini, Grazia Maria; Bahi-Buisson, Nadia; Olaso, Robert; Le Moing, Anne-Gaëlle; Boutourlinsky, Katia; Boucher, Dominique; Carpentier, Wassila; Berquin, Patrick; Deleuze, Jean-François; Belvindrah, Richard; Borrell, Victor; Welker, Egbert; Chelly, Jamel; Croquelois, Alexandre; Francis, Fiona. Mutations in Eml1 lead to ectopic progenitors and neuronal heterotopia in mouse and human. Nature Neuroscience. 2014;17(7):923-33.  PubMed
Zhu, Lifan; Weng, Zhen; Shen, Pengcheng; Zhou, Jianxin; Zeng, Jincai; Weng, Fengbiao; Zhang, Xiaojian; Yang, Huilin. S100B regulates inflammatory response during osteoarthritis via fibroblast growth factor receptor 1 signaling. Molecular Medicine Reports. 2018;18(6):4855-4864.  PubMed
Habela, Christa Whelan; Yoon, Ki-Jun; Kim, Nam-Shik; Taga, Arens; Bell, Kassidy; Bergles, Dwight E; Maragakis, Nicholas J; Ming, Guo-Li; Song, Hongjun. Persistent Cyfip1 Expression Is Required to Maintain the Adult Subventricular Zone Neurogenic Niche. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2020;40(10):2015-2024.  PubMed
Schiweck, Juliane; Murk, Kai; Ledderose, Julia; Münster-Wandowski, Agnieszka; Ornaghi, Marta; Vida, Imre; Eickholt, Britta J. Drebrin controls scar formation and astrocyte reactivity upon traumatic brain injury by regulating membrane trafficking. Nature Communications. 2021;12(1):1490.  PubMed
Ghirotto, Bruno; Oliveira, Danyllo F; Cipelli, Marcella; Basso, Paulo J; de Lima, Jean; Breda, Cristiane N S; Ribeiro, Henrique C; Silva, Camille C C; Sertié, Andrea L; Oliveira, Antonio Edson R; Hiyane, Meire I; Caldini, Elia G; Sussulini, Alessandra; Nakaya, Helder I; Kowaltowski, Alicia J; Oliveira, Enedina M L; Zatz, Mayana; Câmara, Niels O S. MS-Driven Metabolic Alterations Are Recapitulated in iPSC-Derived Astrocytes. Annals Of Neurology. 2022;91(5):652-669.  PubMed
Yao, Zhi; Yuan, Weihao; Xu, Jiankun; Tong, Wenxue; Mi, Jie; Ho, Pak-Cheong; Chow, Dick Ho Kiu; Li, Ye; Yao, Hao; Li, Xu; Xu, Shunxiang; Guo, Jiaxin; Zhu, Qingtang; Bian, Liming; Qin, Ling. Magnesium-Encapsulated Injectable Hydrogel and 3D-Engineered Polycaprolactone Conduit Facilitate Peripheral Nerve Regeneration. Advanced Science (Weinheim, Baden-Wurttemberg, Germany). 2022;9(21):e2202102.  PubMed
Fernandez Cabada, Tamara; Ruben, Massimo; El Merhie, Amira; Proietti Zaccaria, Remo; Alabastri, Alessandro; Petrini, Enrica Maria; Barberis, Andrea; Salerno, Marco; Crepaldi, Marco; Davis, Alexander; Ceseracciu, Luca; Catelani, Tiziano; Athanassiou, Athanassia; Pellegrino, Teresa; Cingolani, Roberto; Papadopoulou, Evie L. Electrostatic polarization fields trigger glioblastoma stem cell differentiation. Nanoscale Horizons. 2022;8(1):95-107.  PubMed
Näslund, Olivia; Lipatnikova, Anna; Dénes, Anna; Lindskog, Cecilia; Bontell, Thomas Olsson; Smits, Anja; Jakola, Asgeir S; Corell, Alba. Meningioma classification by immunohistochemistry: A replicability study. Brain & Spine. 3( 36685704):101711.  PubMed