Protein Description: S100 calcium binding protein A5
Gene Name: S100A5
Alternative Gene Name: S100D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001023: 90%, ENSRNOG00000011748: 90%
Entrez Gene ID: 6276
Uniprot ID: P33763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: S100A5
Alternative Gene Name: S100D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001023: 90%, ENSRNOG00000011748: 90%
Entrez Gene ID: 6276
Uniprot ID: P33763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK |
Documents & Links for Anti S100A5 pAb (ATL-HPA064184) | |
Datasheet | Anti S100A5 pAb (ATL-HPA064184) Datasheet (External Link) |
Vendor Page | Anti S100A5 pAb (ATL-HPA064184) at Atlas |
Documents & Links for Anti S100A5 pAb (ATL-HPA064184) | |
Datasheet | Anti S100A5 pAb (ATL-HPA064184) Datasheet (External Link) |
Vendor Page | Anti S100A5 pAb (ATL-HPA064184) |