Anti S100A5 pAb (ATL-HPA064184)

Catalog No:
ATL-HPA064184-25
$303.00

Description

Product Description

Protein Description: S100 calcium binding protein A5
Gene Name: S100A5
Alternative Gene Name: S100D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001023: 90%, ENSRNOG00000011748: 90%
Entrez Gene ID: 6276
Uniprot ID: P33763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Gene Sequence KELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Gene ID - Mouse ENSMUSG00000001023
Gene ID - Rat ENSRNOG00000011748
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti S100A5 pAb (ATL-HPA064184)
Datasheet Anti S100A5 pAb (ATL-HPA064184) Datasheet (External Link)
Vendor Page Anti S100A5 pAb (ATL-HPA064184) at Atlas Antibodies

Documents & Links for Anti S100A5 pAb (ATL-HPA064184)
Datasheet Anti S100A5 pAb (ATL-HPA064184) Datasheet (External Link)
Vendor Page Anti S100A5 pAb (ATL-HPA064184)

Product Description

Protein Description: S100 calcium binding protein A5
Gene Name: S100A5
Alternative Gene Name: S100D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001023: 90%, ENSRNOG00000011748: 90%
Entrez Gene ID: 6276
Uniprot ID: P33763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Gene Sequence KELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Gene ID - Mouse ENSMUSG00000001023
Gene ID - Rat ENSRNOG00000011748
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti S100A5 pAb (ATL-HPA064184)
Datasheet Anti S100A5 pAb (ATL-HPA064184) Datasheet (External Link)
Vendor Page Anti S100A5 pAb (ATL-HPA064184) at Atlas Antibodies

Documents & Links for Anti S100A5 pAb (ATL-HPA064184)
Datasheet Anti S100A5 pAb (ATL-HPA064184) Datasheet (External Link)
Vendor Page Anti S100A5 pAb (ATL-HPA064184)