Anti S100A2 pAb (ATL-HPA062451 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062451-100

• 
• 

Product Description

Protein Description: S100 calcium binding protein A2
Gene Name: S100A2
Alternative Gene Name: CAN19, S100L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094018: 64%, ENSRNOG00000011821: 56%
Entrez Gene ID: 6273
Uniprot ID: P29034
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVD
• Gene Sequence: EMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVD
• Gene ID - Mouse: ENSMUSG00000094018
• Gene ID - Rat: ENSRNOG00000011821
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti S100A2 pAb (ATL-HPA062451 w/enhanced validation) – 1 Found

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.