Anti RYR1 pAb (ATL-HPA056416 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056416-25

• 
• 

Product Description

Protein Description: ryanodine receptor 1 (skeletal)
Gene Name: RYR1
Alternative Gene Name: CCO, MHS, MHS1, PPP1R137, RYR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030592: 96%, ENSRNOG00000020557: 96%
Entrez Gene ID: 6261
Uniprot ID: P21817
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK
• Gene Sequence: REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK
• Gene ID - Mouse: ENSMUSG00000030592
• Gene ID - Rat: ENSRNOG00000020557
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti RYR1 pAb (ATL-HPA056416 w/enhanced validation) – 1 Found

Gonorazky, Hernan D; Naumenko, Sergey; Ramani, Arun K; Nelakuditi, Viswateja; Mashouri, Pouria; Wang, Peiqui; Kao, Dennis; Ohri, Krish; Viththiyapaskaran, Senthuri; Tarnopolsky, Mark A; Mathews, Katherine D; Moore, Steven A; Osorio, Andres N; Villanova, David; Kemaladewi, Dwi U; Cohn, Ronald D; Brudno, Michael; Dowling, James J. Expanding the Boundaries of RNA Sequencing as a Diagnostic Tool for Rare Mendelian Disease. American Journal Of Human Genetics. 2019;104(3):466-483.