Protein Description: relaxin/insulin-like family peptide receptor 1
Gene Name: RXFP1
Alternative Gene Name: LGR7, RXFPR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034009: 71%, ENSRNOG00000024120: 74%
Entrez Gene ID: 59350
Uniprot ID: Q9HBX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RXFP1
Alternative Gene Name: LGR7, RXFPR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034009: 71%, ENSRNOG00000024120: 74%
Entrez Gene ID: 59350
Uniprot ID: Q9HBX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNS |
| Documents & Links for Anti RXFP1 pAb (ATL-HPA027067) | |
| Datasheet | Anti RXFP1 pAb (ATL-HPA027067) Datasheet (External Link) |
| Vendor Page | Anti RXFP1 pAb (ATL-HPA027067) at Atlas |
| Documents & Links for Anti RXFP1 pAb (ATL-HPA027067) | |
| Datasheet | Anti RXFP1 pAb (ATL-HPA027067) Datasheet (External Link) |
| Vendor Page | Anti RXFP1 pAb (ATL-HPA027067) |
| Citations for Anti RXFP1 pAb (ATL-HPA027067) – 1 Found |
| Burston, Helen E; Kent, Oliver A; Communal, Laudine; Udaskin, Molly L; Sun, Ren X; Brown, Kevin R; Jung, Euihye; Francis, Kyle E; La Rose, Jose; Lowitz, Joshua; Drapkin, Ronny; Mes-Masson, Anne-Marie; Rottapel, Robert. Inhibition of relaxin autocrine signaling confers therapeutic vulnerability in ovarian cancer. The Journal Of Clinical Investigation. 2021;131(7) PubMed |