Protein Description: relaxin/insulin-like family peptide receptor 1
Gene Name: RXFP1
Alternative Gene Name: LGR7, RXFPR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034009: 71%, ENSRNOG00000024120: 74%
Entrez Gene ID: 59350
Uniprot ID: Q9HBX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RXFP1
Alternative Gene Name: LGR7, RXFPR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034009: 71%, ENSRNOG00000024120: 74%
Entrez Gene ID: 59350
Uniprot ID: Q9HBX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNS |
Gene Sequence | PFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNS |
Gene ID - Mouse | ENSMUSG00000034009 |
Gene ID - Rat | ENSRNOG00000024120 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RXFP1 pAb (ATL-HPA027067) | |
Datasheet | Anti RXFP1 pAb (ATL-HPA027067) Datasheet (External Link) |
Vendor Page | Anti RXFP1 pAb (ATL-HPA027067) at Atlas |
Documents & Links for Anti RXFP1 pAb (ATL-HPA027067) | |
Datasheet | Anti RXFP1 pAb (ATL-HPA027067) Datasheet (External Link) |
Vendor Page | Anti RXFP1 pAb (ATL-HPA027067) |
Citations for Anti RXFP1 pAb (ATL-HPA027067) – 1 Found |
Burston, Helen E; Kent, Oliver A; Communal, Laudine; Udaskin, Molly L; Sun, Ren X; Brown, Kevin R; Jung, Euihye; Francis, Kyle E; La Rose, Jose; Lowitz, Joshua; Drapkin, Ronny; Mes-Masson, Anne-Marie; Rottapel, Robert. Inhibition of relaxin autocrine signaling confers therapeutic vulnerability in ovarian cancer. The Journal Of Clinical Investigation. 2021;131(7) PubMed |