Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation)

Catalog No:
ATL-HPA067966-25
$395.00

Description

Product Description

Protein Description: RuvB-like AAA ATPase 2
Gene Name: RUVBL2
Alternative Gene Name: ECP51, INO80J, Reptin52, RVB2, TIH2, TIP48, TIP49b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003868: 97%, ENSRNOG00000020793: 97%
Entrez Gene ID: 10856
Uniprot ID: Q9Y230
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR
Gene Sequence ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR
Gene ID - Mouse ENSMUSG00000003868
Gene ID - Rat ENSRNOG00000020793
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation)
Datasheet Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation)

Product Description

Protein Description: RuvB-like AAA ATPase 2
Gene Name: RUVBL2
Alternative Gene Name: ECP51, INO80J, Reptin52, RVB2, TIH2, TIP48, TIP49b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003868: 97%, ENSRNOG00000020793: 97%
Entrez Gene ID: 10856
Uniprot ID: Q9Y230
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR
Gene Sequence ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR
Gene ID - Mouse ENSMUSG00000003868
Gene ID - Rat ENSRNOG00000020793
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation)
Datasheet Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation)