Protein Description: RuvB-like AAA ATPase 2
Gene Name: RUVBL2
Alternative Gene Name: ECP51, INO80J, Reptin52, RVB2, TIH2, TIP48, TIP49b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003868: 97%, ENSRNOG00000020793: 97%
Entrez Gene ID: 10856
Uniprot ID: Q9Y230
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RUVBL2
Alternative Gene Name: ECP51, INO80J, Reptin52, RVB2, TIH2, TIP48, TIP49b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003868: 97%, ENSRNOG00000020793: 97%
Entrez Gene ID: 10856
Uniprot ID: Q9Y230
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR |
Documents & Links for Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation) | |
Datasheet | Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation) at Atlas |
Documents & Links for Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation) | |
Datasheet | Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RUVBL2 pAb (ATL-HPA067966 w/enhanced validation) |