Anti RUNX3 pAb (ATL-HPA059006 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA059006-25

• 
• 

Product Description

Protein Description: runt-related transcription factor 3
Gene Name: RUNX3
Alternative Gene Name: AML2, CBFA3, PEBP2A3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070691: 87%, ENSRNOG00000054217: 87%
Entrez Gene ID: 864
Uniprot ID: Q13761
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP
• Gene Sequence: DQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP
• Gene ID - Mouse: ENSMUSG00000070691
• Gene ID - Rat: ENSRNOG00000054217
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.