Protein Description: runt-related transcription factor 2
Gene Name: RUNX2
Alternative Gene Name: AML3, CBFA1, CCD, CCD1, PEBP2A1, PEBP2aA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039153: 100%, ENSRNOG00000020193: 81%
Entrez Gene ID: 860
Uniprot ID: Q13950
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RUNX2
Alternative Gene Name: AML3, CBFA1, CCD, CCD1, PEBP2A1, PEBP2aA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039153: 100%, ENSRNOG00000020193: 81%
Entrez Gene ID: 860
Uniprot ID: Q13950
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA |
Documents & Links for Anti RUNX2 pAb (ATL-HPA022040 w/enhanced validation) | |
Datasheet | Anti RUNX2 pAb (ATL-HPA022040 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RUNX2 pAb (ATL-HPA022040 w/enhanced validation) at Atlas |
Documents & Links for Anti RUNX2 pAb (ATL-HPA022040 w/enhanced validation) | |
Datasheet | Anti RUNX2 pAb (ATL-HPA022040 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RUNX2 pAb (ATL-HPA022040 w/enhanced validation) |
Citations for Anti RUNX2 pAb (ATL-HPA022040 w/enhanced validation) – 13 Found |
Holmes, Greg; van Bakel, Harm; Zhou, Xueyan; Losic, Bojan; Jabs, Ethylin Wang. BCL11B expression in intramembranous osteogenesis during murine craniofacial suture development. Gene Expression Patterns : Gep. 2015;17(1):16-25. PubMed |
Castelucci, Bianca Gazieri; Consonni, Sílvio Roberto; Rosa, Viviane Souza; Sensiate, Lucimara Aparecida; Delatti, Paula Cristina Rugno; Alvares, Lúcia Elvira; Joazeiro, Paulo Pinto. Time-dependent regulation of morphological changes and cartilage differentiation markers in the mouse pubic symphysis during pregnancy and postpartum recovery. Plos One. 13(4):e0195304. PubMed |
Schott, Eric M; Farnsworth, Christopher W; Grier, Alex; Lillis, Jacquelyn A; Soniwala, Sarah; Dadourian, Gregory H; Bell, Richard D; Doolittle, Madison L; Villani, David A; Awad, Hani; Ketz, John P; Kamal, Fadia; Ackert-Bicknell, Cheryl; Ashton, John M; Gill, Steven R; Mooney, Robert A; Zuscik, Michael J. Targeting the gut microbiome to treat the osteoarthritis of obesity. Jci Insight. 2018;3(8) PubMed |
Holmes, Greg; Zhang, Lening; Rivera, Joshua; Murphy, Ryan; Assouline, Claudia; Sullivan, Lorraine; Oppeneer, Todd; Jabs, Ethylin Wang. C-type natriuretic peptide analog treatment of craniosynostosis in a Crouzon syndrome mouse model. Plos One. 13(7):e0201492. PubMed |
Motch Perrine, Susan M; Wu, Meng; Stephens, Nicholas B; Kriti, Divya; van Bakel, Harm; Jabs, Ethylin Wang; Richtsmeier, Joan T. Mandibular dysmorphology due to abnormal embryonic osteogenesis in FGFR2-related craniosynostosis mice. Disease Models & Mechanisms. 2019;12(5) PubMed |
Watson, Adam W; Grant, Adam D; Parker, Sara S; Hill, Samantha; Whalen, Michael B; Chakrabarti, Jayati; Harman, Michael W; Roman, Mackenzie R; Forte, Brittany L; Gowan, Cody C; Castro-Portuguez, Raúl; Stolze, Lindsey K; Franck, Christian; Cusanovich, Darren A; Zavros, Yana; Padi, Megha; Romanoski, Casey E; Mouneimne, Ghassan. Breast tumor stiffness instructs bone metastasis via maintenance of mechanical conditioning. Cell Reports. 2021;35(13):109293. PubMed |
Holmes, Greg; Gonzalez-Reiche, Ana S; Saturne, Madrikha; Motch Perrine, Susan M; Zhou, Xianxiao; Borges, Ana C; Shewale, Bhavana; Richtsmeier, Joan T; Zhang, Bin; van Bakel, Harm; Jabs, Ethylin Wang. Single-cell analysis identifies a key role for Hhip in murine coronal suture development. Nature Communications. 2021;12(1):7132. PubMed |
Martínez-Abadías, Neus; Holmes, Greg; Pankratz, Talia; Wang, Yingli; Zhou, Xueyan; Jabs, Ethylin Wang; Richtsmeier, Joan T. From shape to cells: mouse models reveal mechanisms altering palate development in Apert syndrome. Disease Models & Mechanisms. 2013;6(3):768-79. PubMed |
McDonald, Laura; Ferrari, Nicola; Terry, Anne; Bell, Margaret; Mohammed, Zahra M; Orange, Clare; Jenkins, Alma; Muller, William J; Gusterson, Barry A; Neil, James C; Edwards, Joanne; Morris, Joanna S; Cameron, Ewan R; Blyth, Karen. RUNX2 correlates with subtype-specific breast cancer in a human tissue microarray, and ectopic expression of Runx2 perturbs differentiation in the mouse mammary gland. Disease Models & Mechanisms. 2014;7(5):525-34. PubMed |
Ferrari, Nicola; Riggio, Alessandra I; Mason, Susan; McDonald, Laura; King, Ayala; Higgins, Theresa; Rosewell, Ian; Neil, James C; Smalley, Matthew J; Sansom, Owen J; Morris, Joanna; Cameron, Ewan R; Blyth, Karen. Runx2 contributes to the regenerative potential of the mammary epithelium. Scientific Reports. 2015;5( 26489514):15658. PubMed |
Holmes, Greg; O'Rourke, Courtney; Motch Perrine, Susan M; Lu, Na; van Bakel, Harm; Richtsmeier, Joan T; Jabs, Ethylin Wang. Midface and upper airway dysgenesis in FGFR2-related craniosynostosis involves multiple tissue-specific and cell cycle effects. Development (Cambridge, England). 2018;145(19) PubMed |
Catheline, Sarah E; Hoak, Donna; Chang, Martin; Ketz, John P; Hilton, Matthew J; Zuscik, Michael J; Jonason, Jennifer H. Chondrocyte-Specific RUNX2 Overexpression Accelerates Post-traumatic Osteoarthritis Progression in Adult Mice. Journal Of Bone And Mineral Research : The Official Journal Of The American Society For Bone And Mineral Research. 2019;34(9):1676-1689. PubMed |
Yin, Zi; Lin, Junxin; Yan, Ruojin; Liu, Richun; Liu, Mengfei; Zhou, Bo; Zhou, Wenyan; An, Chengrui; Chen, Yangwu; Hu, Yejun; Fan, Chunmei; Zhao, Kun; Wu, Bingbing; Zou, Xiaohui; Zhang, Jin; El-Hashash, Ahmed H; Chen, Xiao; Ouyang, Hongwei. Atlas of Musculoskeletal Stem Cells with the Soft and Hard Tissue Differentiation Architecture. Advanced Science (Weinheim, Baden-Wurttemberg, Germany). 2020;7(23):2000938. PubMed |