Description
Product Description
Protein Description: runt-related transcription factor 1; translocated to, 1 (cyclin D-related)
Gene Name: RUNX1T1
Alternative Gene Name: AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006586: 94%, ENSRNOG00000005673: 94%
Entrez Gene ID: 862
Uniprot ID: Q06455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RUNX1T1
Alternative Gene Name: AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006586: 94%, ENSRNOG00000005673: 94%
Entrez Gene ID: 862
Uniprot ID: Q06455
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPT |
Gene Sequence | RNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPT |
Gene ID - Mouse | ENSMUSG00000006586 |
Gene ID - Rat | ENSRNOG00000005673 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RUNX1T1 pAb (ATL-HPA070951) | |
Datasheet | Anti RUNX1T1 pAb (ATL-HPA070951) Datasheet (External Link) |
Vendor Page | Anti RUNX1T1 pAb (ATL-HPA070951) at Atlas Antibodies |
Documents & Links for Anti RUNX1T1 pAb (ATL-HPA070951) | |
Datasheet | Anti RUNX1T1 pAb (ATL-HPA070951) Datasheet (External Link) |
Vendor Page | Anti RUNX1T1 pAb (ATL-HPA070951) |