Anti RUNDC3A pAb (ATL-HPA070733 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA070733-25

• 

Product Description

Protein Description: RUN domain containing 3A
Gene Name: RUNDC3A
Alternative Gene Name: RAP2IP, RPIP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006575: 98%, ENSRNOG00000020970: 98%
Entrez Gene ID: 10900
Uniprot ID: Q59EK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQK
• Gene Sequence: TDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQK
• Gene ID - Mouse: ENSMUSG00000006575
• Gene ID - Rat: ENSRNOG00000020970
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.