Description
Product Description
Protein Description: receptor (chemosensory) transporter protein 4
Gene Name: RTP4
Alternative Gene Name: IFRG28, Z3CXXC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040040: 32%, ENSRNOG00000009278: 32%
Entrez Gene ID: 64108
Uniprot ID: Q96DX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RTP4
Alternative Gene Name: IFRG28, Z3CXXC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040040: 32%, ENSRNOG00000009278: 32%
Entrez Gene ID: 64108
Uniprot ID: Q96DX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GQGLKSCMTKPSKSLLPHLKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDP |
Gene Sequence | GQGLKSCMTKPSKSLLPHLKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDP |
Gene ID - Mouse | ENSMUSG00000040040 |
Gene ID - Rat | ENSRNOG00000009278 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RTP4 pAb (ATL-HPA071189) | |
Datasheet | Anti RTP4 pAb (ATL-HPA071189) Datasheet (External Link) |
Vendor Page | Anti RTP4 pAb (ATL-HPA071189) at Atlas Antibodies |
Documents & Links for Anti RTP4 pAb (ATL-HPA071189) | |
Datasheet | Anti RTP4 pAb (ATL-HPA071189) Datasheet (External Link) |
Vendor Page | Anti RTP4 pAb (ATL-HPA071189) |