Anti RTP4 pAb (ATL-HPA071189)

Catalog No:
ATL-HPA071189-25
$447.00

Description

Product Description

Protein Description: receptor (chemosensory) transporter protein 4
Gene Name: RTP4
Alternative Gene Name: IFRG28, Z3CXXC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040040: 32%, ENSRNOG00000009278: 32%
Entrez Gene ID: 64108
Uniprot ID: Q96DX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQGLKSCMTKPSKSLLPHLKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDP
Gene Sequence GQGLKSCMTKPSKSLLPHLKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDP
Gene ID - Mouse ENSMUSG00000040040
Gene ID - Rat ENSRNOG00000009278
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RTP4 pAb (ATL-HPA071189)
Datasheet Anti RTP4 pAb (ATL-HPA071189) Datasheet (External Link)
Vendor Page Anti RTP4 pAb (ATL-HPA071189) at Atlas Antibodies

Documents & Links for Anti RTP4 pAb (ATL-HPA071189)
Datasheet Anti RTP4 pAb (ATL-HPA071189) Datasheet (External Link)
Vendor Page Anti RTP4 pAb (ATL-HPA071189)

Product Description

Protein Description: receptor (chemosensory) transporter protein 4
Gene Name: RTP4
Alternative Gene Name: IFRG28, Z3CXXC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040040: 32%, ENSRNOG00000009278: 32%
Entrez Gene ID: 64108
Uniprot ID: Q96DX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQGLKSCMTKPSKSLLPHLKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDP
Gene Sequence GQGLKSCMTKPSKSLLPHLKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDP
Gene ID - Mouse ENSMUSG00000040040
Gene ID - Rat ENSRNOG00000009278
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RTP4 pAb (ATL-HPA071189)
Datasheet Anti RTP4 pAb (ATL-HPA071189) Datasheet (External Link)
Vendor Page Anti RTP4 pAb (ATL-HPA071189) at Atlas Antibodies

Documents & Links for Anti RTP4 pAb (ATL-HPA071189)
Datasheet Anti RTP4 pAb (ATL-HPA071189) Datasheet (External Link)
Vendor Page Anti RTP4 pAb (ATL-HPA071189)