Protein Description: receptor (chemosensory) transporter protein 4
Gene Name: RTP4
Alternative Gene Name: IFRG28, Z3CXXC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066319: 46%, ENSRNOG00000028895: 48%
Entrez Gene ID: 64108
Uniprot ID: Q96DX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RTP4
Alternative Gene Name: IFRG28, Z3CXXC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066319: 46%, ENSRNOG00000028895: 48%
Entrez Gene ID: 64108
Uniprot ID: Q96DX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CSWSQYEMPEFSSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEACTLGICG |
| Documents & Links for Anti RTP4 pAb (ATL-HPA064887) | |
| Datasheet | Anti RTP4 pAb (ATL-HPA064887) Datasheet (External Link) |
| Vendor Page | Anti RTP4 pAb (ATL-HPA064887) at Atlas |
| Documents & Links for Anti RTP4 pAb (ATL-HPA064887) | |
| Datasheet | Anti RTP4 pAb (ATL-HPA064887) Datasheet (External Link) |
| Vendor Page | Anti RTP4 pAb (ATL-HPA064887) |