Anti RTEL1 pAb (ATL-HPA078328)

Catalog No:
ATL-HPA078328-25
$303.00

Description

Product Description

Protein Description: regulator of telomere elongation helicase 1
Gene Name: RTEL1
Alternative Gene Name: bK3184A7.3, C20orf41, DKFZP434C013, KIAA1088, NHL, RTEL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038685: 77%, ENSRNOG00000027513: 77%
Entrez Gene ID: 51750
Uniprot ID: Q9NZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNMELEDIAKLKMILLRLEGAIDAVELPGDDSGVT
Gene Sequence HNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNMELEDIAKLKMILLRLEGAIDAVELPGDDSGVT
Gene ID - Mouse ENSMUSG00000038685
Gene ID - Rat ENSRNOG00000027513
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RTEL1 pAb (ATL-HPA078328)
Datasheet Anti RTEL1 pAb (ATL-HPA078328) Datasheet (External Link)
Vendor Page Anti RTEL1 pAb (ATL-HPA078328) at Atlas Antibodies

Documents & Links for Anti RTEL1 pAb (ATL-HPA078328)
Datasheet Anti RTEL1 pAb (ATL-HPA078328) Datasheet (External Link)
Vendor Page Anti RTEL1 pAb (ATL-HPA078328)

Product Description

Protein Description: regulator of telomere elongation helicase 1
Gene Name: RTEL1
Alternative Gene Name: bK3184A7.3, C20orf41, DKFZP434C013, KIAA1088, NHL, RTEL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038685: 77%, ENSRNOG00000027513: 77%
Entrez Gene ID: 51750
Uniprot ID: Q9NZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNMELEDIAKLKMILLRLEGAIDAVELPGDDSGVT
Gene Sequence HNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNMELEDIAKLKMILLRLEGAIDAVELPGDDSGVT
Gene ID - Mouse ENSMUSG00000038685
Gene ID - Rat ENSRNOG00000027513
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RTEL1 pAb (ATL-HPA078328)
Datasheet Anti RTEL1 pAb (ATL-HPA078328) Datasheet (External Link)
Vendor Page Anti RTEL1 pAb (ATL-HPA078328) at Atlas Antibodies

Documents & Links for Anti RTEL1 pAb (ATL-HPA078328)
Datasheet Anti RTEL1 pAb (ATL-HPA078328) Datasheet (External Link)
Vendor Page Anti RTEL1 pAb (ATL-HPA078328)