Protein Description: regulator of telomere elongation helicase 1
Gene Name: RTEL1
Alternative Gene Name: bK3184A7.3, C20orf41, DKFZP434C013, KIAA1088, NHL, RTEL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038685: 77%, ENSRNOG00000027513: 77%
Entrez Gene ID: 51750
Uniprot ID: Q9NZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RTEL1
Alternative Gene Name: bK3184A7.3, C20orf41, DKFZP434C013, KIAA1088, NHL, RTEL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038685: 77%, ENSRNOG00000027513: 77%
Entrez Gene ID: 51750
Uniprot ID: Q9NZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HNVEKMCEESASFDLTPHDLASGLDVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNMELEDIAKLKMILLRLEGAIDAVELPGDDSGVT |
| Documents & Links for Anti RTEL1 pAb (ATL-HPA078328) | |
| Datasheet | Anti RTEL1 pAb (ATL-HPA078328) Datasheet (External Link) |
| Vendor Page | Anti RTEL1 pAb (ATL-HPA078328) at Atlas |
| Documents & Links for Anti RTEL1 pAb (ATL-HPA078328) | |
| Datasheet | Anti RTEL1 pAb (ATL-HPA078328) Datasheet (External Link) |
| Vendor Page | Anti RTEL1 pAb (ATL-HPA078328) |