Description
Product Description
Protein Description: regulator of telomere elongation helicase 1
Gene Name: RTEL1
Alternative Gene Name: bK3184A7.3, C20orf41, DKFZP434C013, KIAA1088, NHL, RTEL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038685: 53%, ENSRNOG00000027513: 60%
Entrez Gene ID: 51750
Uniprot ID: Q9NZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RTEL1
Alternative Gene Name: bK3184A7.3, C20orf41, DKFZP434C013, KIAA1088, NHL, RTEL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038685: 53%, ENSRNOG00000027513: 60%
Entrez Gene ID: 51750
Uniprot ID: Q9NZ71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PKKHNLLQGFYQFVRPHHKQQFEEVCIQLTGRGCGYRPEHSIPRRQRAQPVLDPTGRTAPDPKLTVSTAAAQQLDPQEHLNQG |
Gene Sequence | PKKHNLLQGFYQFVRPHHKQQFEEVCIQLTGRGCGYRPEHSIPRRQRAQPVLDPTGRTAPDPKLTVSTAAAQQLDPQEHLNQG |
Gene ID - Mouse | ENSMUSG00000038685 |
Gene ID - Rat | ENSRNOG00000027513 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RTEL1 pAb (ATL-HPA067329) | |
Datasheet | Anti RTEL1 pAb (ATL-HPA067329) Datasheet (External Link) |
Vendor Page | Anti RTEL1 pAb (ATL-HPA067329) at Atlas Antibodies |
Documents & Links for Anti RTEL1 pAb (ATL-HPA067329) | |
Datasheet | Anti RTEL1 pAb (ATL-HPA067329) Datasheet (External Link) |
Vendor Page | Anti RTEL1 pAb (ATL-HPA067329) |