Protein Description: ribosomal L24 domain containing 1
Gene Name: RSL24D1
Alternative Gene Name: C15orf15, HRP-L30-iso, L30, RPL24, RPL24L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032215: 99%, ENSRNOG00000052787: 99%
Entrez Gene ID: 51187
Uniprot ID: Q9UHA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RSL24D1
Alternative Gene Name: C15orf15, HRP-L30-iso, L30, RPL24, RPL24L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032215: 99%, ENSRNOG00000052787: 99%
Entrez Gene ID: 51187
Uniprot ID: Q9UHA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQ |
| Documents & Links for Anti RSL24D1 pAb (ATL-HPA063392 w/enhanced validation) | |
| Datasheet | Anti RSL24D1 pAb (ATL-HPA063392 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RSL24D1 pAb (ATL-HPA063392 w/enhanced validation) at Atlas |
| Documents & Links for Anti RSL24D1 pAb (ATL-HPA063392 w/enhanced validation) | |
| Datasheet | Anti RSL24D1 pAb (ATL-HPA063392 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RSL24D1 pAb (ATL-HPA063392 w/enhanced validation) |