Anti RSL24D1 pAb (ATL-HPA062724 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062724-25

• 
• 
• 

Product Description

Protein Description: ribosomal L24 domain containing 1
Gene Name: RSL24D1
Alternative Gene Name: C15orf15, HRP-L30-iso, L30, RPL24, RPL24L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032215: 100%, ENSRNOG00000052787: 98%
Entrez Gene ID: 51187
Uniprot ID: Q9UHA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH
• Gene Sequence: QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH
• Gene ID - Mouse: ENSMUSG00000032215
• Gene ID - Rat: ENSRNOG00000052787
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.